Loading...
Statistics
Advertisement

Promastix.com

Advertisement
Conversion Technology Metas Server
Promastix.com is hosted in United States / Lansing . Promastix.com uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Flexslider, Html, Number of used javascripts: 5. First javascripts: Jquery.min.js, Bootstrap.js, Jquery.flexslider-min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4.

Technologies in use by Promastix.com

Technology

Number of occurences: 5
  • CSS
  • Flexslider
  • Html
  • Html5
  • Javascript

Advertisement

Javascripts

Number of occurences: 5
  • jquery.min.js
  • bootstrap.js
  • jquery.flexslider-min.js
  • jquery.tweet.js
  • script.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Promastix.com

SSL certificate

    • name: /CN=host3.sellinginsights.com/emailAddress=ssl@host3.sellinginsights.com
    • subject:
      • CN: host3.sellinginsights.com
      • emailAddress: ssl@host3.sellinginsights.com
    • hash: a70215b5
    • issuer:
      • CN: host3.sellinginsights.com
      • emailAddress: ssl@host3.sellinginsights.com
    • version: 2
    • serialNumber: 8033898926
    • validFrom: 151112044201Z
    • validTo: 161111044201Z
    • validFrom_time_t: 1447303321
    • validTo_time_t: 1478839321
    • extensions:
      • subjectKeyIdentifier: 9D:09:8E:42:63:E1:C7:70:A4:94:DC:55:D7:34:9E:01:A3:E0:FA:EB
      • authorityKeyIdentifier: keyid:9D:09:8E:42:63:E1:C7:70:A4:94:DC:55:D7:34:9E:01:A3:E0:FA:EB
      • basicConstraints: CA:FALSE

Meta - Promastix.com

Number of occurences: 4
  • Name:
    Content: IE=edge,chrome=1
  • Name: description
    Content: Selling Insights based theme
  • Name: viewport
    Content: width=device-width, initial-scale=1.0
  • Name: apple-mobile-web-app-capable
    Content: yes

Server / Hosting

  • IP: 67.227.192.181
  • Latitude: 42.73
  • Longitude: -84.64
  • Country: United States
  • City: Lansing

Rname

  • ns.liquidweb.com
  • ns1.liquidweb.com
  • promastix.com

Target

  • admin.liquidweb.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 10 Apr 2016 23:17:35 GMT Server: Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 Last-Modified: Wed, 20 Mar 2013 22:59:39 GMT ETag: "1406d8-720f-4d8632d3a4cc0" Accept-Ranges: bytes Content-Length: 29199 Content-Type: text/html

DNS

host: promastix.com
  1. class: IN
  2. ttl: 299
  3. type: A
  4. ip: 67.227.192.181
host: promastix.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns.liquidweb.com
host: promastix.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns1.liquidweb.com
host: promastix.com
  1. class: IN
  2. ttl: 300
  3. type: SOA
  4. mname: ns.liquidweb.com
  5. rname: admin.liquidweb.com
  6. serial: 2012042626
  7. refresh: 28800
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 14400
host: promastix.com
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 0
  5. target: promastix.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.romastix.com, www.piromastix.com, www.iromastix.com, www.pkromastix.com, www.kromastix.com, www.puromastix.com, www.uromastix.com, www.pjromastix.com, www.jromastix.com, www.plromastix.com, www.lromastix.com, www.pomastix.com, www.priomastix.com, www.piomastix.com, www.proomastix.com, www.poomastix.com, www.prlomastix.com, www.plomastix.com, www.prlomastix.com, www.plomastix.com, www.pr.omastix.com, www.p.omastix.com, www.prmastix.com, www.probmastix.com, www.prbmastix.com, www.prohmastix.com, www.prhmastix.com, www.progmastix.com, www.prgmastix.com, www.projmastix.com, www.prjmastix.com, www.prommastix.com, www.prmmastix.com, www.pro mastix.com, www.pr mastix.com, www.provmastix.com, www.prvmastix.com, www.proastix.com, www.prompastix.com, www.propastix.com, www.promoastix.com, www.prooastix.com, www.promiastix.com, www.proiastix.com, www.promkastix.com, www.prokastix.com, www.prom.astix.com, www.pro.astix.com, www.promuastix.com, www.prouastix.com, www.promjastix.com, www.projastix.com, www.promnastix.com, www.pronastix.com, www.prom-astix.com, www.pro-astix.com, www.promstix.com, www.promaostix.com, www.promostix.com, www.promapstix.com, www.prompstix.com, www.proma9stix.com, www.prom9stix.com, www.promastix.com, www.promstix.com, www.promaistix.com, www.promistix.com, www.promaustix.com, www.promustix.com, www.promatix.com, www.promasetix.com, www.promaetix.com, www.promaswtix.com, www.promawtix.com, www.promasdtix.com, www.promadtix.com, www.promasxtix.com, www.promaxtix.com, www.promasftix.com, www.promaftix.com, www.promasgtix.com, www.promagtix.com, www.promasttix.com, www.promattix.com, www.promasix.com, www.promastqix.com, www.promasqix.com, www.promastaix.com, www.promasaix.com, www.promast ix.com, www.promas ix.com, www.promastwix.com, www.promaswix.com, www.promasteix.com, www.promaseix.com, www.promastzix.com, www.promaszix.com, www.promastxix.com, www.promasxix.com, www.promastcix.com, www.promascix.com, www.promastx.com, www.promastirx.com, www.promastrx.com, www.promastifx.com, www.promastfx.com, www.promastivx.com, www.promastvx.com, www.promastikx.com, www.promastkx.com, www.promasti,x.com, www.promast,x.com, www.promastibx.com, www.promastbx.com, www.promastigx.com, www.promastgx.com, www.promastitx.com, www.promasttx.com, www.promastiyx.com, www.promastyx.com, www.promastiux.com, www.promastux.com, www.promastijx.com, www.promastjx.com, www.promastimx.com, www.promastmx.com, www.promastinx.com, www.promastnx.com, www.promasti.com, www.promastixq.com, www.promastiq.com, www.promastix.com, www.promasti.com, www.promastixa.com, www.promastia.com, www.promastixs.com, www.promastis.com, www.promastixd.com, www.promastid.com, www.promastixe.com, www.promastie.com,

Other websites we recently analyzed

  1. 给料网-每天都免费！
    Central District (Hong Kong) - 103.27.176.52
    Server software: IIS
    Technology: Html, Php
    Number of meta tags: 1
  2. 8560.de - Diese Website steht zum Verkauf! - Informationen zum Thema 8 560.
    Diese Website steht zum Verkauf! 8560.de ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 8560.de alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Cambridge (United States) - 72.52.4.90
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  3. Charlemagne
    United Kingdom - 185.19.14.71
    Server software: Microsoft-IIS/7.5
    Technology: Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, Google Tagmanager
    Number of Javascript: 9
    Number of meta tags: 3
  4. academiccredittransferpathway.ca
    Scottsdale (United States) - 184.168.221.46
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  5. Jich.de
    Germany - 88.198.231.9
    Server software: Apache/2.4.10 (Debian)
    Technology: CSS, Html, Html5, Javascript, jQuery
    Number of Javascript: 15
    Number of meta tags: 4
  6. nutritionnews.net
    Switzerland - 141.8.225.124
    Server software: Apache
    Technology: Html
  7. Home
    Servicios de Transporte Generales
    Scottsdale (United States) - 107.180.25.128
    Server software: Apache/2.4.23
    Technology: Carousel, CSS, Font Awesome, Html, Html5, Javascript, Php
    Number of Javascript: 14
    Number of meta tags: 4
  8. fishinggears.net
    Los Angeles (United States) - 208.73.210.100
    Server software: Microsoft-IIS/8.5
    Technology: CloudFront, Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 2
  9. Home Page - Padre Pasquale Incoronato
    Padre Pasquale Incoronato,parroco della Parrocchia Santa Maria del Pilar in Ercolano, da alcuni anni si occupa del recupero sociale, familiare e personale, di minori definiti
    Arezzo (Italy) - 31.11.32.89
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Iframe, Javascript, Php, Swf Object
    Number of Javascript: 3
    Number of meta tags: 7
  10. imprimerepgraficas.es
    Germany - 217.160.230.20
    Server software: Apache
    Technology: Html
    Number of meta tags: 1

Check Other Websites